PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G22950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 26856.4 Da    PI: 9.4759
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G22950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.14.7e-281059251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     ri+n++ rqvtfskRrngi+KKA+EL +LCdaev ++ifsstg+lyeyss
  ORUFI02G22950.1 10 RIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSS 59
                     8***********************************************96 PP

2K-box94.61.6e-3175170398
            K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                      +++ +++ +++ + +q+e+a L+++++nLq+++R+l+GedL+ L++keLq+Le+qLe sl+++R+kK+++l+++i+el +k   +++en++L k
  ORUFI02G22950.1  75 EQQAVANPNSELKFWQREAASLRQQLHNLQENHRQLMGEDLSGLNVKELQSLENQLEISLRSVRTKKDHVLIDEIHELNRKGSLVHQENMELYK 168
                      56777789999*********************************************************************************** PP

            K-box  97 kl 98 
                      k+
  ORUFI02G22950.1 169 KI 170
                      98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.651161IPR002100Transcription factor, MADS-box
CDDcd002653.39E-44277No hitNo description
SuperFamilySSF554551.03E-32291IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-273859IPR002100Transcription factor, MADS-box
PfamPF014868.7E-3083170IPR002487Transcription factor, K-box
PROSITE profilePS5129716.39486176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KAKELAILCD AEVGLMIFSS TGRLYEYSST  60
SMKSVIDRYG KSKDEQQAVA NPNSELKFWQ REAASLRQQL HNLQENHRQL MGEDLSGLNV  120
KELQSLENQL EISLRSVRTK KDHVLIDEIH ELNRKGSLVH QENMELYKKI SLIRQENAEL  180
YKKIYETEGP SEVNRDSPTP YNFAVIEKTN VPVQLGLSTL PQHSDAEQST APKLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-19183183Myocyte-specific enhancer factor 2B
1tqe_Q1e-19183183Myocyte-specific enhancer factor 2B
1tqe_R1e-19183183Myocyte-specific enhancer factor 2B
1tqe_S1e-19183183Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAPTransfer from AT3G57230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1776960.0AY177696.1 Oryza sativa (japonica cultivar-group) transcription factor MADS27 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626695.11e-174PREDICTED: MADS-box transcription factor 27
SwissprotQ6EP491e-176MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A0D3F6V11e-174A0A0D3F6V1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0CMG21e-174A0A0E0CMG2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NGW01e-174A0A0E0NGW0_ORYRU; Uncharacterized protein
TrEMBLB8AED31e-174B8AED3_ORYSI; Putative uncharacterized protein
TrEMBLB9F0Q91e-174B9F0Q9_ORYSJ; Uncharacterized protein
STRINGBGIOSGA008494-PA1e-174(Oryza sativa Indica Group)
STRINGLOC_Os02g36924.11e-174(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.11e-102AGAMOUS-like 16